Rabbit Polyclonal Anti-CMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA |
Mast Cell Chymase (CMA1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 81-247 of human Mast Cell Chymase (Mast Cell Chymase (CMA1)) (NP_001827.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China