Primary Antibodies

View as table Download

Goat Polyclonal Anti-beta-Actin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli.

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V).
Modifications Phospho-specific

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

Goat Anti-Desmin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDGEVVSEATQQQHE, from the C Terminus of the protein sequence according to NP_001918.3.

Rabbit Polyclonal antibody to alpha Actin (cardiac muscle) (actin, alpha, cardiac muscle 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 99 and 354 of alpha Actin (cardiac muscle) (Uniprot ID#P68032)

Anti-TPM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta)

Anti-TPM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta)

Anti-TPM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta)

Anti-TNNI3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit Polyclonal Anti-LMNA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LMNA