Primary Antibodies

Jump to Filters
View as table Download
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA329505

USD 485.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA350642

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-CRH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRH
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308888

USD 625.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323637

USD 380.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
PLA2G2D (C-term) Rabbit Polyclonal Antibody
AP53324PU-N

USD 580.00

2 Weeks

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D
PLA2G3 Rabbit Polyclonal Antibody
TA308426

USD 625.00

2 Weeks

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)
IGF1 Rabbit Polyclonal Antibody
PP1020P2

USD 465.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA308889

USD 535.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Dog, Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA323636

USD 380.00

2 Weeks

Anti-GNAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus
Corticotropin Releasing Factor (CRH) Rabbit Polyclonal Antibody
TA349055

USD 570.00

5 Days

Rabbit Polyclonal Anti-CRH Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CRH antibody was raised against a 16 amino acid peptide near the amino terminus of human CRH.
IGF1 Rabbit Polyclonal Antibody
PP1020P1

USD 345.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA346203

USD 485.00

5 Days

Rabbit Polyclonal Anti-GNAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ
IGF1 Goat Polyclonal Antibody
TA311185

USD 520.00

5 Days

Goat Anti-IGF1 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig, Rabbit)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1.
PLA2G12A (Center) Rabbit Polyclonal Antibody
AP53322PU-N

USD 580.00

2 Weeks

PLA2G12A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 54-83 amino acids from the Central region of human PLA2G12A
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA332753

USD 365.00

3 Weeks

Rabbit anti-GNAS Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAS