Primary Antibodies

View as table Download

Anti-CSNK1A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.

Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Casein Kinase I a (Ab-321) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Casein Kinase I a around the phosphorylation site of threonine 321 (A-Q-TP-P-T).

Casein Kinase 1 alpha (CSNK1A1) chicken polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CSNK1A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

CSNK1A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1