Rabbit Polyclonal Anti-IKBKE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKE |
Rabbit Polyclonal Anti-IKBKE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKE |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal RIP3/RIPK3 Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 497-522 (isoform CRA_a, 518 amino acids) and 298-335 (isoform CRA_b, 319 amino acids) of human RIP3 was used as immunogen for this antibody. |
Rabbit Polyclonal IKK beta Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK beta antibody was raised against a peptide corresponding to amino acids near the carboxy-terminus of human IKK beta (Genbank accession NoO14920), which differs from corresponding murine sequence by one amino acid. |
Rabbit anti-CHUK Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CHUK |
Rabbit Polyclonal anti-IKBKB Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKB |
RIP3 (RIPK3) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human RIPK3. |
IKK alpha (CHUK) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IKK alpha (CHUK) (+IKKB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-IKK beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKKb peptide corresponding to the highly conserved C-terminus region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
IKBKE Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKE |
Rabbit Polyclonal Anti-RIPK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
Rabbit Polyclonal anti-IKBKB Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKB |