Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal RIP3/RIPK3 Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 497-522 (isoform CRA_a, 518 amino acids) and 298-335 (isoform CRA_b, 319 amino acids) of human RIP3 was used as immunogen for this antibody. |
Rabbit Polyclonal IKK beta Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IKK beta antibody was raised against a peptide corresponding to amino acids near the carboxy-terminus of human IKK beta (Genbank accession NoO14920), which differs from corresponding murine sequence by one amino acid. |
RIP3 (RIPK3) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human RIPK3. |
IKBKE Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IKBKE |
Rabbit Polyclonal Anti-RIPK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
Active filters
Category
- Antibodies
Applications
- WB
Clonalities
- Polyclonal
Families
- Protein Kinase
Pathways
- Cytosolic DNA-sensing pathway