Primary Antibodies

View as table Download

CNGA4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 138-168 amino acids from the N-terminal region of human CNGA4

Rabbit Polyclonal Anti-CNGA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ