Primary Antibodies

View as table Download

Anti-CNGA2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 475-662 amino acids of human cyclic nucleotide gated channel alpha 2

Rabbit Polyclonal antibody to CNGA2 (cyclic nucleotide gated channel alpha 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 412 and 664 of CNGA2 (Uniprot ID#Q16280)

Anti-HCN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 874-886 amino acids of Human hyperpolarization activated cyclic nucleotide-gated potassium channel 1

Anti-CNGA3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 482-605 amino acids of human cyclic nucleotide gated channel alpha 3

Rabbit polyclonal anti-CNGA1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNGA1.

HCN1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human HCN1

Rabbit Polyclonal Anti-CNGA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ

Rabbit Polyclonal Anti-HCN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HCN3 antibody: synthetic peptide directed towards the middle region of human HCN3. Synthetic peptide located within the following region: LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV