Rabbit polyclonal anti-HTR5A antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HTR5A. |
Rabbit polyclonal anti-HTR5A antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HTR5A. |
5HT5A receptor (HTR5A) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids N-terminus of Human SR-5A. |
Rabbit polyclonal anti-5-HT-5A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-5A. |
Rabbit Polyclonal Anti-HTR5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR5A antibody: synthetic peptide directed towards the N terminal of human HTR5A. Synthetic peptide located within the following region: DLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLV |
Rabbit Polyclonal Anti-HTR5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HTR5A Antibody: synthetic peptide directed towards the N terminal of human HTR5A. Synthetic peptide located within the following region: MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFL |
Rabbit Polyclonal Anti-5-HT-5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-5-HT-5A Antibody: A synthesized peptide derived from human 5-HT-5A |