Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Mouse, Human, Bovine, Dog, Macaque, Rat, Opossum
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.