Primary Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody
AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
WNT2 Rabbit Polyclonal Antibody
TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2
WNT3A Rabbit Polyclonal Antibody
TA349804

USD 380.00

In Stock

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A
GLI1 Rabbit Polyclonal Antibody
TA309673

USD 550.00

In Stock

Rabbit Polyclonal Gli1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]
GLI2 Rabbit Polyclonal Antibody
TA329437

USD 485.00

5 Days

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE
WNT5A Rabbit Polyclonal Antibody
TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
GLI3 Rabbit Polyclonal Antibody
TA319303

USD 765.00

2 Weeks

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 445.00

3 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 550.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
Smoothened (SMO) (N-term) Rabbit Polyclonal Antibody
AP23648PU-N

USD 500.00

2 Weeks

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated
Axin 2 (AXIN2) Rabbit Polyclonal Antibody
TA332534

USD 365.00

2 Weeks

Rabbit anti-AXIN2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AXIN2
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA336926

USD 550.00

5 Days

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]
DVL1 Rabbit Polyclonal Antibody
TA324487

USD 580.00

5 Days

Rabbit polyclonal DVL1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA330025

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP