Primary Antibodies

Jump to Filters
View as table Download
CRLF2 Rabbit Polyclonal Antibody
TA351093

USD 380.00

In Stock

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRLF2
CRLF2 Mouse Polyclonal Antibody
TA336941

USD 550.00

5 Days

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.
CRLF2 Mouse Polyclonal Antibody
TA336942

USD 550.00

5 Days

Mouse Polyclonal TSLP R/CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody.
CRLF2 Rabbit Polyclonal Antibody
TA336112

USD 539.00

5 Days

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF