Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rabbit, Rat, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378) |
Rabbit Polyclonal Anti-GATM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN |
Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557) |
Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330) |
Goat Polyclonal Antibody against MAOB
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Germany
Japan
United Kingdom
China
