Mouse monoclonal anti-TUBB4(beta IV Tubulin) antibody, clone 5C1, Loading, clone OTI5C1 (formerly 5C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Mouse monoclonal anti-TUBB4(beta IV Tubulin) antibody, clone 5C1, Loading, clone OTI5C1 (formerly 5C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Mouse monoclonal anti-TUBB4(beta IV Tubulin) antibody, clone 5C1, Loading, clone OTI5C1 (formerly 5C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TUBB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI |