Primary Antibodies

Jump to Filters
View as table Download
CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]
TA807575

USD 447.00

In Stock

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA506513

USD 447.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
CD40 Mouse Monoclonal Antibody [Clone ID: OTI1F12]
TA807575S

USD 200.00

2 Days

CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI3H10]
TA808184

USD 447.00

In Stock

TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications WB
Reactivities Human
Conjugation Unconjugated
IL10 (Center) Rabbit Polyclonal Antibody
AP52181PU-N

USD 580.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1C1]
TA506513S

USD 200.00

In Stock

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS