Primary Antibodies

Jump to Filters
View as table Download
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325661

USD 380.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3
p38 (MAPK14) Rabbit Polyclonal Antibody [Clone ID: N/A]
TA326350

USD 440.00

2 Weeks

Rabbit polyclonal p38 Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Rabbit, Pig, Canine, Chicken, Sheep, Hamster, Guinea Pig
Conjugation Unconjugated
Immunogen A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH.
MMP2 Rabbit Polyclonal Antibody
TA330021

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA346746

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAP3K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH