Primary Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) Goat Polyclonal Antibody
AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.
WNT3A Rabbit Monoclonal Antibody [Clone ID: OTIR4G6]
TA592927

USD 428.00

In Stock

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
WNT3A Rabbit Polyclonal Antibody
TA349804

USD 380.00

In Stock

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 380.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
TCF7L2 Rabbit Polyclonal Antibody
TA333645

USD 539.00

In Stock

Rabbit Polyclonal Anti-TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
p53 (TP53) Goat Polyclonal Antibody
AB0154-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
BMP4 Rabbit Polyclonal Antibody
TA323208

USD 380.00

In Stock

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
p53 (TP53) Goat Polyclonal Antibody
AB0065-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
Frizzled 8 (FZD8) Goat Polyclonal Antibody
TA303076

USD 520.00

In Stock

Goat Polyclonal Antibody against FZD8

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYPKQMPLSQV, from the C Terminus of the protein sequence according to NP_114072.1.
APC Rabbit Polyclonal Antibody
TA313458

USD 380.00

In Stock

Rabbit polyclonal anti-APC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human APC.
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA321813

USD 380.00

In Stock

Anti-FZD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4
WNT10B Rabbit Polyclonal Antibody
TA306582

USD 570.00

In Stock

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.
Frizzled 5 (FZD5) Rabbit Polyclonal Antibody
TA311714

USD 380.00

In Stock

Rabbit polyclonal anti-FZD5 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.
beta Catenin (CTNNB1) Rabbit Polyclonal Antibody
TA313136

USD 380.00

In Stock

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.
FZD3 Rabbit Polyclonal Antibody
TA314709

USD 380.00

In Stock

Rabbit polyclonal anti-FZD3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD3.