Primary Antibodies

View as table Download

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4

Anti-AKR1B10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4

Rabbit Polyclonal Anti-CYP1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP1A2

Goat Polyclonal Antibody against AKR1B10

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSSHLEDYPFDAE, from the C Terminus of the protein sequence according to NP_064695.2.

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2E1

Rabbit polyclonal anti-PA2G6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PA2G6.

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Goat Anti-ALOX15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3.

Rabbit polyclonal Cytochrome P450 3A7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7.

Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19.

Rabbit Polyclonal c-PLA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2

Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505
Modifications Phospho-specific