Primary Antibodies

View as table Download

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1

Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734)

Rabbit Polyclonal Anti-ETV7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETV7

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.

Rabbit polyclonal Notch 2 (Cleaved-Asp1733) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 2.

Rabbit polyclonal EGFR (Ab-1071) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EGFR

Rabbit polyclonal MAPK1/3 (Ab-205/222) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MAPK1.

Rabbit Polyclonal anti-NOTCH4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human NOTCH4

Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1070
Modifications Phospho-specific

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2

Rabbit Polyclonal Anti-PIWIL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Goat Polyclonal Anti-ERBB1 Antibody

Applications WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.

Rabbit polyclonal NOTCH2 (Cleaved-Ala1734) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NOTCH2.

Rabbit polyclonal anti-SOS2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SOS2.

Anti-NOTCH1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of human notch 1