Primary Antibodies

View as table Download

Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mouse, Rat, Sheep
Conjugation Unconjugated
Immunogen Collagen type II purified from Human knee and Bovine nasal cartilage.

Rabbit Polyclonal Antibody against LC3

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121).

Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker

Applications ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Feline, Dog
Conjugation Unconjugated
Immunogen Full-length recombinant human survivin.

Rabbit Polyclonal Ki-67/MKI67 Antibody

Applications FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013]
TA336650 is a possible alternative to TA336566.

Rabbit Polyclonal Antibody against DRP1

Applications FC, IHC, IP
Reactivities Human, Primate, Mouse, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429]

Rabbit Polyclonal Antibody against ATG5

Applications Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0]

TOM20 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Modifications Unmodified

Rabbit Polyclonal Antibody against APE1

Applications Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein.

Rabbit Polyclonal Antibody against MAT2 alpha

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153]

CD133 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human CD133

CTCF Rabbit polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1).
Modifications Unmodified

Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327)

Rabbit Polyclonal anti-HSPA9 antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

Acetyl-Histone H3-K18 Rabbit polyclonal Antibody

Applications ChIP, ChIP-seq, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Other (Wide Range)
Conjugation Unconjugated
Immunogen A synthetic acetylated peptide corresponding to residues surrounding K18 of human H3
Modifications Acetyl K18

mTOR Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human mTOR (NP_004949.1).
Modifications Unmodified