PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody,clone 1F9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
PHKG2 mouse monoclonal antibody,clone 1F9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
PHKG2 mouse monoclonal antibody,clone 2E5, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
PHKG2 mouse monoclonal antibody,clone 2E5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHKG2 |
PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PHKG2 |
PHKG2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHKG2 |
PHKG2 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PHKG2. |
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV |