Primary Antibodies

Jump to Filters
View as table Download
IL33 Rabbit Polyclonal Antibody
AP32086PU-N

USD 465.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
AP32086PU-S

USD 345.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
TA368251

USD 380.00

4 Weeks

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33
IL33 Rabbit Polyclonal Antibody
AP08936PU-N

USD 500.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to a 19 amino acid peptide from near the center of Human IL33.
IL33 Rabbit Polyclonal Antibody
TA339875

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
IL33 Rabbit Polyclonal Antibody
TA372490

USD 380.00

4 Weeks

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33