Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DCX Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR

Doublecortin (DCX) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 271-320 of Human Doublecortin.

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Doublecortin (DCX) mouse monoclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Chicken, Equine, Human, Mouse, Porcine, Primate, Rat
Conjugation Unconjugated