DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |