BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI10B11 (formerly 10B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI8H5 (formerly 8H5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI8H2 (formerly 8H2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI8A8 (formerly 8A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε. |
SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3 |
CRY2 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CRY2. |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
CLOCK mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CLOCK mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CLOCK mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CLOCK mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BHLHE41 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PER3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |