Primary Antibodies

Jump to Filters
View as table Download
TPTEP2-CSNK1E Rabbit Polyclonal Antibody
AP20419PU-N

USD 465.00

3 Weeks

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
AP20458PU-N

USD 445.00

3 Weeks

SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3
CRY2 (C-term) Rabbit Polyclonal Antibody
AP13098PU-N

USD 580.00

2 Weeks

CRY2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CRY2.
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA329741

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
CLOCK Mouse Monoclonal Antibody [Clone ID: OTI2C3]
TA804773S

USD 200.00

2 Days

CLOCK mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CLOCK Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA804782S

USD 200.00

2 Days

CLOCK mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CLOCK Mouse Monoclonal Antibody [Clone ID: OTI4A6]
TA804825S

USD 200.00

2 Days

CLOCK mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CLOCK Mouse Monoclonal Antibody [Clone ID: OTI2G10]
TA804826S

USD 200.00

2 Days

CLOCK mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PER3 Rabbit Polyclonal Antibody
AP20426PU-N

USD 465.00

3 Weeks

PER3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated