Primary Antibodies

View as table Download

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

CD79A Rabbit monoclonal antibody,clone OTIR5E2

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit Polyclonal c-Fos Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Anti-MAP2K1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 15-28 amino acids of human mitogen-activated protein kinase kinase 1

Anti-PTPN6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6

Anti-MAP2K2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human mitogen-activated protein kinase kinase 2

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon