Primary Antibodies

View as table Download

Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))

Applications IF, IHC, WB
Reactivities Human (Predicted: Rat, Dog, Pig, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062)

Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

PSMB5 goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Bovine, Bat, Canine, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen PSMB5 antibody was raised against synthetic peptide from human PSMB5 / MB1