Primary Antibodies

View as table Download

Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Monkey, Rat, Porcine, Horse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936]

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.

Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6

Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253)

Rabbit Polyclonal Cathepsin D Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.

Anti-MMP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase)

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Anti-ADAMTS16 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1076-1090 amino acids of human ADAM metallopeptidase with thrombospondin type 1 motif, 16

Rabbit Polyclonal Anti-TMPRSS6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.

Anti-AGA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-346 amino acids of human aspartylglucosaminidase

Goat Polyclonal Anti-Cathepsin D Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.