ENaC Gamma Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide C-SNQLTDTQMLDE from the C-terminus of human SCNN1G (NP_001030.2). Percent identity by BLAST analysis: Human, Gorilla, Marmoset (100%); Monkey (92%); Elephant (83%). |
GJA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
KCNMB1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse monoclonal KvBeta1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-KvBeta1.1 Antibody
| Applications | IHC |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-BKBeta4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Bat, Horse, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
GJB1 mouse monoclonal antibody, clone CXN-32, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
