Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 25 results

Page 1 of 2

(reset)

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA503442

USD 447.00

In Stock

CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

CF503442

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F11]

TA503442AM

USD 509.00

5 Days

CYP17A1 mouse monoclonal antibody,clone 3F11, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F11]

TA503442BM

USD 509.00

5 Days

CYP17A1 mouse monoclonal antibody,clone 3F11, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

TA503442S

USD 200.00

2 Days

CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

CYP11A1 Rabbit Polyclonal Antibody

TA339994

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

AKR1D1 Rabbit Polyclonal Antibody

TA324084

USD 380.00

In Stock

Anti-AKR1D1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CYP21A2 Rabbit Polyclonal Antibody

TA349853

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human CYP21A2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HSD11B2 Rabbit Polyclonal Antibody

TA351267

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HSD11B2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human HSD11B2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

HSD11B1 Rabbit Polyclonal Antibody

TA308504

USD 625.00

5 Days

Rabbit polyclonal antibody to HSD11B1 (hydroxysteroid (11-beta) dehydrogenase 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 232 and 292 of HSD11B1

1 / 3

2 / 3

3 / 3

Previous Next

CYP11B1 Rabbit Polyclonal Antibody

TA342857

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications	IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated
Immunogen	The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CYP11B1 Rabbit Polyclonal Antibody

TA349847

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human CYP11B1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CYP11A1 Rabbit Polyclonal Antibody

TA349851

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human CYP11A1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytochrome P450 17A1 (CYP17A1) Rabbit Polyclonal Antibody

TA349852

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP17A1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human CYP17A1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

AKR1D1 Rabbit Polyclonal Antibody

TA324085

USD 380.00

In Stock

Anti-AKR1D1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

1 / 3

2 / 3

3 / 3

Previous Next

1 - 15 of 25 results

Page 1 of 2