HSD17B8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSD17B8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HSD17B8 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSD17B8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSD17B8 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
5 Days
HSD17B8 mouse monoclonal antibody,clone 2E12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HSD17B8 mouse monoclonal antibody,clone 2E12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
5 Days
HSD17B8 mouse monoclonal antibody,clone 6H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Biotin |
HSD17B8 mouse monoclonal antibody,clone 6H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal Cytochrome P450 19A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1. |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-HSD17B2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B2 |
Rabbit Polyclonal Anti-HSD11B2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HSD11B2 |
Rabbit Polyclonal Anti-HSD17B1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HSD17B1 |
Aromatase (CYP19A1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SRD5A2 Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |