Primary Antibodies

View as table Download

CPS1 mouse monoclonal antibody, clone UMAB281

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

CPS1 mouse monoclonal antibody, clone UMAB282

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB281

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB282

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI

CPS1 mouse monoclonal antibody, clone UMAB281

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

CPS1 mouse monoclonal antibody, clone UMAB282

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL

CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated