Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Rabbit polyclonal CDK4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit Polyclonal ATM Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM. |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Rabbit anti-ATM (Phospho-Ser1981) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATM around the phosphorylation site of serine 1981 (E-G-SP-Q-S). |
Modifications | Phospho-specific |
Rabbit polyclonal Chk2 (Thr387) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 387 (C-G-TP-P-T). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit polyclonal Chk2 (Ab-68) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 68. |
Rabbit polyclonal anti-cdk2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Chicken, Bovine |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Phospho-CDK2-T160 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T160 of human CDK2 |
Modifications | Phospho-specific |
Rabbit polyclonal Chk1 (Ser296) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk1 around the phosphorylation site of serine 296 (I-Q-SP-N-L). |
Modifications | Phospho-specific |
Rabbit polyclonal ATR (Ser428) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATR around the phosphorylation site of serine 428 (G-I-SP-P-K). |
Modifications | Phospho-specific |