Primary Antibodies

View as table Download

SRP72 (Center) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 126~156 amino acids from the Center region of Human SRP72

Rabbit Polyclonal Anti-SRP54 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SRP54

Rabbit Polyclonal Anti-SRP14 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

Rabbit Polyclonal Anti-SRP68 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SRP68

Rabbit Polyclonal Anti-SRP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK