Primary Antibodies

View as table Download

Rabbit Polyclonal CD4 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730]

Rabbit Polyclonal Calnexin Antibody

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565]

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

Rabbit Polyclonal Calnexin Antibody

Applications FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Goat Anti-Calnexin Antibody

Applications IF, IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKTPELNLDQFHDKT, from the internal region (near N-Terminus) of the protein sequence according to NP_001737.1.

Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Sheep, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A

Rabbit Polyclonal GRP78/HSPA5 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Chicken, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human GRP78 (within residues 250-300). [Swiss-Prot# P11021]

Rabbit Polyclonal Calreticulin Antibody

Applications Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Primate
Conjugation Unconjugated
Immunogen A fusion protein to mouse Calreticulin [UniProt# P14211]

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

Rabbit Polyclonal HSP70/HSPA1A Antibody

Applications FC, ICC/IF, IHC, Simple Western
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Hsp70 protein (between residues 550-600) [UniProt P08107]

Rabbit polyclonal anti-GRP78 / HSPA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GRP78.

Rabbit Polyclonal Calreticulin Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A full-length protein to mouse Calreticulin [UniProt# P14211]

Goat Polyclonal Antibody against HSPA8 (Isoform 1)

Applications IF, IHC, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKLQGKINDEDKQK, from the internal region of the protein sequence according to NP_006588.1.

Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)

Applications IHC, WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233)