Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal GTF2I Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This GTF2I antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 956-985 amino acids from the C-terminal region of human GTF2I. |
Rabbit Polyclonal Anti-GTF2I Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2I antibody: synthetic peptide directed towards the N terminal of human GTF2I. Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH |
Rabbit Polyclonal Anti-GTF2I Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2I antibody: synthetic peptide directed towards the N terminal of human GTF2I. Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH |
Rabbit polyclonal TBPL2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBPL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TBPL2. |
