Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal CHOP/GADD153 Antibody (9C8)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E11)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Chicken, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal c-Myc Antibody
Applications | ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal c-Fos Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
p38 (CRK) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
Applications | ELISA, FN, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |