Primary Antibodies

View as table Download

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal ATM Antibody

Applications ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315]

Rabbit Polyclonal c-Myc Antibody

Applications ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal BubR1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal CDKN2A Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A.

Rabbit Polyclonal p18 INK4c Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal p16INK4a / CDKN2A/p14ARF Antibody

Applications ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a portion of human p14ARF (between residues 50-150). [Swiss-Prot# Q8N726]

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Cyclin A2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

DNA PKcs (PRKDC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

DP1 (TFDP1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated