NKX3-1 mouse monoclonal antibody,clone UMAB195
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
NKX3-1 mouse monoclonal antibody,clone UMAB195
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone UMAB214
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
SYT4 mouse monoclonal antibody,clone UMAB141
Applications | 10k-ChIP, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AMACR mouse monoclonal antibody,clone UMAB215
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
NCAM1/CD56 mouse monoclonal antibody,clone UMAB194
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PD-L2 (PDCD1LG2) mouse monoclonal antibody, clone UMAB224
Applications | 10k-ChIP, FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF21 mouse monoclonal antibody, clone UMAB71
Applications | 10k-ChIP, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ALX4 mouse monoclonal antibody,clone UMAB118
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HEMGN mouse monoclonal antibody,clone UMAB169
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NAPSA mouse monoclonal antibody,clone UMAB213
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB271
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB272
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Suv420h1
Applications | 10k-ChIP, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC |
Rabbit Polyclonal Anti-TAF2 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH |
Rabbit Polyclonal Anti-TAF4 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL |