Primary Antibodies

View as table Download

AMACR mouse monoclonal antibody,clone UMAB214

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

AMACR mouse monoclonal antibody,clone UMAB215

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

NCAM1/CD56 mouse monoclonal antibody,clone UMAB194

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PD-L2 (PDCD1LG2) mouse monoclonal antibody, clone UMAB224

Applications 10k-ChIP, FC, WB
Reactivities Human
Conjugation Unconjugated

FGF21 mouse monoclonal antibody, clone UMAB71

Applications 10k-ChIP, IF, IHC
Reactivities Human
Conjugation Unconjugated

ALX4 mouse monoclonal antibody,clone UMAB118

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB271

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

VISTA(C10ORF54) mouse monoclonal antibody,clone UMAB272

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-Suv420h1

Applications 10k-ChIP, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH

Rabbit Polyclonal Anti-TAF4 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL