Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CDA (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N-terminal residues of Human Cytidine Deaminase. |
CDA rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between aa 51-83 from the Center region of human CDA. |
CDA (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-146 amino acids from the C-term region of human CDA. |
Rabbit Polyclonal Anti-CDA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ |
Active filters
Target Symbol
- CDA
Reactivities
- Human
Antibody Hosts
- Rabbit