Primary Antibodies

Jump to Filters
View as table Download
PSMD8 Rabbit Polyclonal Antibody
TA322953

USD 380.00

In Stock

Anti-PSMD8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
PSMD8 Rabbit Polyclonal Antibody
TA322954

USD 380.00

In Stock

Anti-PSMD8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
PSMD8 Rabbit Polyclonal Antibody
TA346574

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSMD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD8 antibody: synthetic peptide directed towards the C terminal of human PSMD8. Synthetic peptide located within the following region: DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV