Primary Antibodies

View as table Download

Rabbit polyclonal Anti-PSMA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2. Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV

Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6

Rabbit Polyclonal Anti-THOC1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC1 antibody: synthetic peptide directed towards the C terminal of human THOC1. Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Anti-PSMD3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3

Anti-PSMD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3

Anti-PSMD3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3

Anti-PSMD14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14

Anti-PSMD14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14

Anti-PSMD6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6

Anti-PSMD6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6

Rabbit Polyclonal Anti-PSMB7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB7

Rabbit Polyclonal Anti-PSMC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMC2

Rabbit Polyclonal Anti-PSMC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMC1

Rabbit Polyclonal Anti-PSMB8 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PSMB8

Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3