Rabbit Polyclonal Aldolase B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Aldolase B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
Applications | WB |
Reactivities | Human, Mouse (Predicted: Chicken, Dog, Pig, Rat, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
Anti-ALDOA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human aldolase A, fructose-bisphosphate |
Anti-ALDOA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human aldolase A, fructose-bisphosphate |
Anti-ALDOB Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 109-122 amino acids of human aldolase B, fructose-bisphosphate |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBP1 |
Rabbit Polyclonal Anti-TALDO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TALDO1 |
Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858) |
Rabbit Polyclonal Anti-FBP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBP2 |
Rabbit Polyclonal Anti-TKTL1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TKTL1 |
Rabbit Polyclonal Anti-TKT Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TKT |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Anti-ALDOB Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 109-122 amino acids of human aldolase B, fructose-bisphosphate |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |