Rabbit polyclonal anti-CA1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA1. |
Rabbit polyclonal anti-CA1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA1. |
Carbonic Anhydrase I (CA1) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 67-98 amino acids from the N-terminal region of human CA1 |
Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Anti-CA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-CA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit anti-CA1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CA1 |