Rabbit Polyclonal Anti-ACOT4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACOT4 antibody is: synthetic peptide directed towards the middle region of Human ACOT4. Synthetic peptide located within the following region: NALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH |
Rabbit Polyclonal Anti-FADS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FADS1 antibody: synthetic peptide directed towards the N terminal of human FADS1. Synthetic peptide located within the following region: RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF |
Rabbit Polyclonal Anti-GPSN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV |
ELOVL6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FADS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FADS1 |
ACOT2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human ACOT2 |
ACOT7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACOT7 |
ACOT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACOT1 |
ACOT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACOT1 |
HADHA Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HADHA |
ACOT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACOT1 |
Germany
Japan
United Kingdom
China