Primary Antibodies

View as table Download

HDAC4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HDAC4

Rabbit Polyclonal Anti-Hdac4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL

Rabbit polyclonal HDAC4 (Ab-632) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632.

Anti-HDAC4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 536-548 amino acids of Human histone deacetylase 4

Anti-HDAC4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 536-548 amino acids of Human histone deacetylase 4

HDAC4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HDAC4

HDAC4 (194-209) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding amino acids 194-209 of human HDAC4.

Rabbit Polyclonal HDAC4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC4

Rabbit Polyclonal HDAC4 (Ser632) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HDAC4 around the phosphorylation site of Serine 632
Modifications Phospho-specific

HDAC4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 451-650 of human HDAC4 (NP_006028.2).
Modifications Unmodified

Rabbit anti-HDAC4 (Phospho-Ser632) polyclonal antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanHDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P).
Modifications Phospho-specific

HDAC4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC4 (NP_006028.2).
Modifications Unmodified

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal HDAC4 (Ser632) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HDAC4 around the phosphorylation site of serine 632 (A-Q-SP-S-P).
Modifications Phospho-specific