Primary Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

Rabbit Polyclonal Anti-ACSL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG

FADS2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of Human FADS2

Rabbit Polyclonal Anti-ACSL4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4

Rabbit Polyclonal Anti-OLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLR1

Rabbit Polyclonal Antibody against CD36

Applications ICC/IF, IHC, WB
Reactivities Human, Bovine, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 100-200.

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

Anti-SLC27A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A2

Rabbit Polyclonal Antibody against CD36

Applications FC, ICC/IF, IHC, Immunoblotting, SDS-PAGE, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 300-400.

Anti-SLC27A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 630-646 amino acids of human solute carrier family 27 (fatty acid transporter), member 1

Anti-CPT1A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human carnitine palmitoyltransferase 1A (liver)

Rabbit Polyclonal Anti-CPT1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA