Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal Glut4 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672]

Rabbit Polyclonal PTPN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4

PDE3B (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 400-427 amino acids from the Central region of Human PDE3B

Rabbit Polyclonal Anti-SLC2A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A4 Antibody: synthetic peptide directed towards the N terminal of human SLC2A4. Synthetic peptide located within the following region: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV

GLUT4 (SLC2A4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal PPP1R3A Antibody (Center)

Applications FC, WB
Reactivities Human (Predicted: Rabbit)
Conjugation Unconjugated
Immunogen This PPP1R3A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 754-782 amino acids from the Central region of human PPP1R3A.

Rabbit Polyclonal PTP1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PTP1B