Rabbit polyclonal ELF4 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This ELF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 211-237 amino acids from the Central region of human ELF4. |
Rabbit polyclonal anti-ELF4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELF4. |
ELF4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 168-196aa) of human ELF4. |
Rabbit Polyclonal anti-ELF4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: RKTKGNRSTSPVTDPSIPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKY |
Rabbit Polyclonal Anti-ELF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the C terminal of human ELF4. Synthetic peptide located within the following region: VTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS |
Rabbit Polyclonal Anti-ELF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELF4 antibody: synthetic peptide directed towards the N terminal of human ELF4. Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS |
Germany
Japan
United Kingdom
China
