Germany
Japan
United Kingdom
China
Anti-TFF1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-TFF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFF1 antibody: synthetic peptide directed towards the middle region of human TFF1. Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Active filters
Target Symbol
- TFF1
Antibody Hosts
- Rabbit
Families
- Secreted Protein