Primary Antibodies

Jump to Filters
View as table Download
Estrogen Related Receptor gamma (ESRRG) Rabbit Polyclonal Antibody
TA340728

USD 515.00

5 Days

Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Bat, Xenopus, Zebrafish)
Conjugation Unconjugated
Immunogen ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%).
Estrogen Related Receptor gamma (ESRRG) Rabbit Polyclonal Antibody
TA338273

USD 539.00

5 Days

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
Estrogen Related Receptor gamma (ESRRG) Rabbit Polyclonal Antibody
TA338272

USD 539.00

5 Days

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN
Estrogen Related Receptor gamma (ESRRG) Rabbit Polyclonal Antibody
TA324999

USD 580.00

5 Days

Rabbit polyclonal ESRRG Antibody (Center)

Applications WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG.
Estrogen Related Receptor gamma (ESRRG) Rabbit Polyclonal Antibody
TA340971

USD 515.00

5 Days

Rabbit Polyclonal Anti-ESRRG Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Chicken, Xenopus)
Conjugation Unconjugated
Immunogen ESRRG / ERR Gamma antibody was raised against synthetic 14 amino acid peptide from N-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit (100%); Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus (93%); Zebrafish (86%).